Site Traffic
Daily Visitors by Country / Region
Where are the visitors who visited the website Identitystation.com?
Daily Visitors (Last 90 days)
The chart below shows how many visitors visited the website Identitystation.com every day for the past 90 days.
Daily Visitors by Subdomain
What subdomains visitors often go on Identitystation.com?
Daily Visitors by Keyword
What search keywords send traffic to the website Identitystation.com?
Linking In & Out
What websites did visitors come from, and then what websites did they go to.
Site Domain
Domain profile
Here is the domain information about Identitystation.com .
Domain Name: | Identitystation.com |
---|---|
Domain Age: | 19 years |
Time Left: | -2 years |
Domain Owner: | Dentist Identity |
Owner's Email: | [email protected] |
Name server: | |
Domain Status: | |
Updated Date: | 2021-03-08 |
Creation Date: | 2005-03-22 |
Expiration Date: | 2022-03-22 |
Sponsor: | PDR Ltd. d/b/a PublicDomainRegistry.com |
Sponsor URL: | https://icann.org |
Domain Whois
Domain Whois is a query and response protocol that is widely used for querying databases that store the registered users or assignees of a domain name. The following information is the Whois of the domain Identitystation.com. Learn more Whois
DNS Record
The Domain Name System (DNS) is a hierarchical and decentralized naming system for computers, services, or other resources connected to the Internet or a private network. It associates various information with domain names assigned to each of the participating entities. The table below shows the DNS record for the domain name Identitystation.com.
Name Server
The table below shows the Name Server for the domain name Identitystation.com.
Site Server
Server Location
Where are Identitystation.com website's servers located?
# | IP Address | Country / Region | City |
---|---|---|---|
1 | 173.203.187.1 | United States | - |
Site Referrals
Similar Sites
What websites are similar to the website Identitystation.com on the web?
- Digital Marketing Course Training in Mumbai-100% Placement Assistant |
- Dotcomvidya.com
- Rank: #10,950,985 Visitors: 2,200
- With Meta Tags you can edit and experiment with your content then preview how your webpage will look on Google, Facebook, Twitte ...
- Digital Marketing Agency Wichita KS - Web Design, Local SEO, Social Media
- Quantumwavesdigitalmarketingagency.com
- Rank: #6,257,992 Visitors: 4,000
- We at Quantum Waves Digital Marketing Agency show you the money and get you more customers! We can help grow and expand your bus ...
- Superfiber Net ? Conecting Digitaly
- Superfibernet.in
- Rank: #8,589,038 Visitors: 3,000
- Webpostcenter : Article Submission and Online Sharing Stories
- Webpostcenter.com
- Rank: #7,987,687 Visitors: 3,200
- Webpostcenter: Article Submission is a process of publishing articles to the article directories to get backlinks. It plays an i ...
- Cryptoamy – Empire of Crypto News
- CRYptoamy.com
- Rank: #4,770,227 Visitors: 4,800
- India's No-1 Cheap Hosting Service Provider | Reseller Program |
- Rclixenhosting.in
- Rank: #7,935,385 Visitors: 3,300
- We provide reliable Linux, window, server solutions with unlimited data to streamline your business operations in a highly share ...
- Vishwajeetdvc
- Vishwajeetdvc.in
- Rank: #9,877,491 Visitors: 2,600
Other sites hosted on the same server
What websites are stored on the same server as the website Identitystation.com?
Other sites owned
What websites are owned by the same person who owns that Identitystation.com website? The websites below are owned by the same owner or not.
Backward Links
What websites are linking to the website Identitystation.com?